PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1529s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 529aa    MW: 59320 Da    PI: 7.0557
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1529s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.11.9e-24130230198
                             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                             f+kvlt sd++++g +++ +k+a+e+     +++++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF
  SapurV1A.1529s0070.2.p 130 FCKVLTASDTSTHGGFSVLRKHASEClppldMIQPTPTQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLLAGDSFVF 216
                             99****************************988888888************************************************ PP

                             EE-SSSEE..EEEEE- CS
                      B3  83 kldgrsefelvvkvfr 98 
                                + +++el+v+v+r
  SapurV1A.1529s0070.2.p 217 V--RGENGELRVGVRR 230
                             *..449999*****98 PP

2Auxin_resp107.61.4e-35256335183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st+s F v+Y+Pr+  s+F+++++k+++a+++k++vGmRfkm+fe+eds+err+sGt+vgv+d++  +W++SkWrsLk
  SapurV1A.1529s0070.2.p 256 ASHAISTQSLFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRFKMRFEGEDSPERRFSGTIVGVEDFSC-HWNDSKWRSLK 335
                             789***************6..9**********************************************665.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.45E-39121259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.3E-40122245IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-19128230No hitNo description
PfamPF023622.4E-22130230IPR003340B3 DNA binding domain
SMARTSM010193.4E-23130232IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111130232IPR003340B3 DNA binding domain
PfamPF065073.8E-33256335IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MMGMNREGGG SLSQGNSEGC GEDDLYMELW KACAGPLVDV PKRGERVFYF PQGHMEQLEA  60
STNQELNQRI PLFNLPSKIL CRVIHVQLLA EQETDEVYAQ ITLLPETDQI EPTSSDSCPS  120
EPPRPTVHSF CKVLTASDTS THGGFSVLRK HASECLPPLD MIQPTPTQEL AAKDLHGYEW  180
RFKHIFRGQP RRHLLTTGWS TFVTSKRLLA GDSFVFVRGE NGELRVGVRR VARQQSSMPS  240
SMISSQSMHL GVLATASHAI STQSLFVVYY KPRTSQFIIS LNKYLEAVNN KFAVGMRFKM  300
RFEGEDSPER RFSGTIVGVE DFSCHWNDSK WRSLKVQWDE PASFPRPDRV SPWEIEPCVA  360
SVPTNLSQTV QPKNKRPRPP IEIPAFGKKE FWFLFLSFEY LMSWSLQSLT VVVGSPTIID  420
LSSTASTPWN SGLAQSRDLA QLSVTGEGKR NENHVMRHQK QTDINGHSNS MTRTQGEGGW  480
LSYVNVSQHL FQDSMEDSKS VSPWPVFLGY STPLSSKSKN DPIPDPSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-179133577354Auxin response factor 1
4ldw_A1e-179133577354Auxin response factor 1
4ldw_B1e-179133577354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1374378KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022476.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLA0A067K0G30.0A0A067K0G3_JATCU; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9