PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1529s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 529aa    MW: 59320 Da    PI: 7.0557
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1529s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.11.9e-24130230198
                             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                             f+kvlt sd++++g +++ +k+a+e+     +++++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF
  SapurV1A.1529s0070.2.p 130 FCKVLTASDTSTHGGFSVLRKHASEClppldMIQPTPTQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLLAGDSFVF 216
                             99****************************988888888************************************************ PP

                             EE-SSSEE..EEEEE- CS
                      B3  83 kldgrsefelvvkvfr 98 
                                + +++el+v+v+r
  SapurV1A.1529s0070.2.p 217 V--RGENGELRVGVRR 230
                             *..449999*****98 PP

2Auxin_resp107.61.4e-35256335183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st+s F v+Y+Pr+  s+F+++++k+++a+++k++vGmRfkm+fe+eds+err+sGt+vgv+d++  +W++SkWrsLk
  SapurV1A.1529s0070.2.p 256 ASHAISTQSLFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRFKMRFEGEDSPERRFSGTIVGVEDFSC-HWNDSKWRSLK 335
                             789***************6..9**********************************************665.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.45E-39121259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.3E-40122245IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-19128230No hitNo description
PfamPF023622.4E-22130230IPR003340B3 DNA binding domain
SMARTSM010193.4E-23130232IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111130232IPR003340B3 DNA binding domain
PfamPF065073.8E-33256335IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MMGMNREGGG SLSQGNSEGC GEDDLYMELW KACAGPLVDV PKRGERVFYF PQGHMEQLEA  60
STNQELNQRI PLFNLPSKIL CRVIHVQLLA EQETDEVYAQ ITLLPETDQI EPTSSDSCPS  120
EPPRPTVHSF CKVLTASDTS THGGFSVLRK HASECLPPLD MIQPTPTQEL AAKDLHGYEW  180